PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G058200.1
Common NamePHAVU_004G058200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 812aa    MW: 93563.8 Da    PI: 6.7791
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G058200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR169.67.6e-22140226290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +Y+ YA + GFsvrk+  +ks+ ng +++r+++C ++g+r +++ +    r+ ++etrtgC a++++ ++ +gk++vt++e+eHnHe++
  Phvul.004G058200.1 140 CYSMYAVQKGFSVRKDFVNKSRINGAVVSRRYTCHRQGYRPNKNGT--FLRKFQQETRTGCLAHMTIARQPNGKFQVTHFETEHNHEFV 226
                         7***************************************998877..99999**********************************97 PP

2FAR189.93.4e-28273361190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +fYn+YA +vGFsvrk++ ++sk +g + +r+f+C +eg+r++++++  + +r+r+ tr+gC a+l+++++ dg+++vt++e++HnHel+
  Phvul.004G058200.1 273 EFYNTYAGRVGFSVRKDYVNRSKIDGAVASRRFTCFREGFRQKDRRD-MNPKRPRKDTRIGCLAQLVISRQPDGRYHVTHFEEKHNHELV 361
                         6*******************************************999.999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.6E-20140226IPR004330FAR1 DNA binding domain
PfamPF031011.6E-25273361IPR004330FAR1 DNA binding domain
PfamPF105515.7E-23476569IPR018289MULE transposase domain
PfamPF044344.7E-4745791IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.545756792IPR007527Zinc finger, SWIM-type
SMARTSM005757.6E-4767794IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MEGTEPDIER QPLEDAEKEC PISAEVVIDM GQESQTRNPS DSSVADTIKV IDTGNECTDP  60
NVCPVDHSHM EINDECQTSN IFHVDKFHND NVSSGQLCEN PCATSVNVSM PSTDVKNENE  120
IYVAPKIGME FESEDNAYKC YSMYAVQKGF SVRKDFVNKS RINGAVVSRR YTCHRQGYRP  180
NKNGTFLRKF QQETRTGCLA HMTIARQPNG KFQVTHFETE HNHEFVTPCT AHMLPSQKRL  240
SFAQAIEANL TVSGLDEVPK LGMGFDSDEH AYEFYNTYAG RVGFSVRKDY VNRSKIDGAV  300
ASRRFTCFRE GFRQKDRRDM NPKRPRKDTR IGCLAQLVIS RQPDGRYHVT HFEEKHNHEL  360
VAACRVHLLR SQKGLTATQI ENLVDGSNLL PTSTSETNCK ARLGSDPIGR DYKLPFKCTI  420
NIKEGEIEKI KHHFRSKQSK NPSFFYAFQL DADDQITNIF WADTKMMVDY TDFGDVVCFD  480
SSYKYYKDSR PFVPFLGINN HQQMTIFGAA LLYNESVESL KWLFVVFLQA MSGRKPKTIL  540
TDLDVVTAEA LNAILPETNH RVCVWHVYQD ALKHLSHVSA GSDSFVNDLR SCLFHHEEED  600
YFVNEWNALM DNYNLWENEW LQQIFGSRDR WAIAYRRQFF CADIESMLLR ENLSGNLKRY  660
LKHDSDILPL FKYLVKVVTD WHYKELDANF DMSQRMPPLL GNIITLKHAS APYTPKIFEL  720
FQKEYEACLN LVIKHCTENG SLYYYKVSVY EQAREYSVTF DSSNETISCC CMKFEYVGIL  780
CCHALKVLDY VNIRIVPSRY ILKRWTKDAR V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151573.10.0hypothetical protein PHAVU_004G058200g
TrEMBLV7C0600.0V7C060_PHAVU; Uncharacterized protein
STRINGGLYMA05G06351.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-106FAR1-related sequence 5